Model portefeuille
Rendement portefeulle
+12.035 %

Rendement AEX
+33.325 %

Startdatum
01-01-2009

Startwaarde portefeuille € 74082.37

Startwaarde AEX
€ 245.94


Laatste update:
29-01-2010

BAM realiseert in Q1 2017 gecorrigeerd resultaat van € 4,9 miljoen en verbetert financiële positie verder

Alleen voor leden beschikbaar, wordt daarom gratis lid!

Algemeen advies 11/05/2017 07:59
? Bouw en Vastgoed: goede resultaten bij Nederlands vastgoed en turnaround in Duitsland
? Infra: resultaat in Duitsland lager (sterk Q1 2016), teruggehouden door Nederland en olie en gas
? Pps: stabiel resultaat vanuit bestaande portefeuille
? Orderportefeuille: verbetering kwaliteit houdt aan; enigszins hoger niveau
? Sterke recourse nettokaspositie weerspiegelt voortgaande verbetering handelswerkkapitaal-efficiency

(x € miljoen, tenzij anders aangegeven)
Kerncijfers
Eerste kwartaal 2017 Eerste kwartaal 2016 Boekjaar 2016
Opbrengsten 1.383 1.542 6.976
Gecorrigeerd* resultaat vóór belastingen 4,9 8,0 102,7
Resultaat vóór belastingen 4,6 8,2 60,1
Orderportefeuille (ultimo) 10.300 10.200
* Voor herstructurering, bijzondere waardeverminderingen en pensioenbate.

Rob van Wingerden, CEO van Koninklijke BAM Groep: ‘Wij zetten het goede momentum voort bij het realiseren van onze strategie ‘Building the present, creating the future’. De refocus van de Duitse bouwactiviteiten is goed op weg en we zien de eerste effecten van de reorganisatie van onze Nederlandse bouw- en vastgoedactiviteiten. In april, tijdens ons capital markets event, hebben we getoond hoe wij de kwaliteit van onze projectenportefeuille bevorderen, onze One BAM-cultuur versterken en onze digitaliseringstrategie implementeren. Wij hebben tevens onze expertise op het gebied van publiek-private samenwerking en internationale onshore-projecten toegelicht.
We hebben onze handelswerkkapitaal-efficiency gedurende het kwartaal verbeterd. Dat heeft bijgedragen aan een hogere recourse nettokaspositie vergeleken met een jaar geleden. Dit kwartaal hebben de Management Board en onze veiligheidsspecialisten een workshop georganiseerd over leiderschap op het gebied van veiligheid om het veiligheidsgedrag naar het volgende niveau te brengen.
In wat gewoonlijk ons zwakste kwartaal is, waren de prestaties van onze sectoren gemengd. Vooruitkijkend, blijven we optimistisch en realistisch over de meeste van onze markten. Voor het gehele jaar 2017 verwachten wij dat de opbrengsten enigszins lager en het gecorrigeerd resultaat vóór belastingen hoger zullen zijn dan het niveau van 2016. Wij voorzien aanzienlijk lagere herstructureringskosten dan in 2016.'

zie & lees verder op
http://www.bam.com/sites/default/files/domain-606/documents/bam-2017-05-11-q1-2017-nl-persbericht-606-1494479944313161498.pdf

EN
10 mei 2017
Gemeente Bloemendaal en AM geven startsein bouw Résidence Vijverpark in Overveen

Gemeente Bloemendaal en AM geven startsein bouw Résidence Vijverpark in Overveen
Ontwikkeling luxe appartementengebouw in co-creatie met betrokkenen
Overveen, 10 mei 2017 - Gebieds- en vastgoedontwikkelaar AM geeft 11 mei aanstaande het startsein voor de realisatie van Résidence Vijverpark in Overveen. Het appartementengebouw met 26 luxueuze nieuwbouwappartementen bestaat uit vijf verschillende gebouwdelen met elk een eigen architectuurstijl. Het ontwerp is conform het I AM YOU- model van AM in nauwe samenspraak met stakeholders, omwonenden en de gemeente Bloemendaal tot stand gekomen onder supervisie van een kwaliteitsteam onder voorzitterschap van Sjoerd Soeters. In het bijzijn van de toekomstige bewoners en andere betrokkenen verricht wethouder Richard Kruijswijk van de gemeente Bloemendaal samen met Peter Heuvelink, directeur AM Noordwest, de officiële handeling.

tijd 17.05
BAM EUR 5,037 -42,3ct vol. 9,2 miljoen.



Beperkte weergave !
Leden hebben toegang tot meer informatie! Omdat u nog geen lid bent of niet staat ingelogd, ziet u nu een beperktere pagina. Wordt daarom GRATIS Lid of login met uw wachtwoord


Copyrights © 2000 by XEA.nl all rights reserved
Niets mag zonder toestemming van de redactie worden gekopieerd, linken naar deze pagina is wel toegestaan.


Copyrights © DEBELEGGERSADVISEUR.NL